PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400013090
Common NameLOC102595949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24657.1 Da    PI: 8.6912
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400013090genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.74.3e-30959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien+snrqvt+skRrngilKKA+E+SvLCda v+viif+++gk++e+ss
  PGSC0003DMP400013090  9 KRIENSSNRQVTYSKRRNGILKKAKEISVLCDAHVSVIIFATSGKMHEFSS 59
                          79***********************************************96 PP

2K-box87.72.2e-2969164196
                 K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                           y+k +g++l++ak+e+l++e++k+kk ++n+q e+Rhl+Ged++sL+++eL+ Le++Le +l+ iR+k+ne++++  +++q++e+e+++
  PGSC0003DMP400013090  69 YHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDISSLNYRELMILEDALEIGLTGIRDKQNEFVRMVRKKTQNMEQEQDQ 157
                           78999999********************************************************************************* PP

                 K-box  90 enkaLrk 96 
                            n +Lr+
  PGSC0003DMP400013090 158 LNCQLRQ 164
                           *****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.693161IPR002100Transcription factor, MADS-box
CDDcd002651.86E-41278No hitNo description
SuperFamilySSF554552.88E-35294IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-283859IPR002100Transcription factor, MADS-box
PfamPF014868.5E-1780162IPR002487Transcription factor, K-box
PROSITE profilePS5129713.59882173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGILK KAKEISVLCD AHVSVIIFAT SGKMHEFSST  60
PLVDILDQYH KLTGRRLWDA KHENLDNEIN KVKKDNDNMQ IELRHLKGED ISSLNYRELM  120
ILEDALEIGL TGIRDKQNEF VRMVRKKTQN MEQEQDQLNC QLRQLEIASM NRNMGEVGEV  180
FEQTRENHDY GQMPFAFRVQ PMQPNLHQRF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-17269168Myocyte-specific enhancer factor 2A
3mu6_B2e-17269168Myocyte-specific enhancer factor 2A
3mu6_C2e-17269168Myocyte-specific enhancer factor 2A
3mu6_D2e-17269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8534170.0HQ853417.1 Iochroma cyaneum MADS box transcription factor (GLO1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361522.11e-156PREDICTED: floral homeotic protein FBP1
SwissprotQ034881e-136FBP1_PETHY; Floral homeotic protein FBP1
TrEMBLM1ABL01e-156M1ABL0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000190701e-156(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46802139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.19e-75MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]